Antibodies

Jump to Filters
View as table Download
ASXL2 Rabbit Polyclonal Antibody
TA344889

USD 475.00

5 Days

Rabbit Polyclonal Anti-ASXL2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASXL2 antibody: synthetic peptide directed towards the middle region of human ASXL2. Synthetic peptide located within the following region: EEAPVSWEKRPRVTENRQHQQPFQVSPQPFLNRGDRIQVRKVPPLKIPVS
ASXL2 Rabbit Polyclonal Antibody
TA365495

USD 380.00

4 Weeks

ASXL2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ASXL2
ASXL2 Rabbit Polyclonal Antibody
TA369807

USD 380.00

4 Weeks

ASXL2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ASXL2