Rabbit polyclonal anti-CABP7 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CABP7. |
Rabbit polyclonal anti-CABP7 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CABP7. |
Rabbit Polyclonal CaBP7 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CaBP7 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human CaBP7. |
Rabbit Polyclonal Anti-CABP7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CABP7 Antibody is: synthetic peptide directed towards the C-terminal region of Human CABP7. Synthetic peptide located within the following region: LYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQIRQTCVR |
CABP7 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human CABP7 (NP_872333.1). |
Modifications | Unmodified |