Antibodies

View as table Download

Rabbit polyclonal anti-CABP7 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CABP7.

Rabbit Polyclonal CaBP7 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CaBP7 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human CaBP7.

Rabbit Polyclonal Anti-CABP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CABP7 Antibody is: synthetic peptide directed towards the C-terminal region of Human CABP7. Synthetic peptide located within the following region: LYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQIRQTCVR

CABP7 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human CABP7 (NP_872333.1).
Modifications Unmodified