Rabbit Polyclonal anti-CGRRF1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CGRRF1 antibody: synthetic peptide directed towards the middle region of human CGRRF1. Synthetic peptide located within the following region: KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIIS |
CGRRF1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CGRRF1 |
CGRRF1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 40-170 of human CGRRF1 (NP_006559.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China