Rabbit polyclonal antibody to Cartilage-associated protein (cartilage associated protein)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 122 and 363 of Cartilage-associated protein (Uniprot ID#O75718) |
Rabbit Polyclonal Anti-CRTAP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRTAP antibody: synthetic peptide directed towards the N terminal of human CRTAP. Synthetic peptide located within the following region: RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF |
CRTAP Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human CRTAP |
CRTAP Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-240 of human CRTAP (NP_006362.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
