DND1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DND1 |
DND1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DND1 |
Rabbit Polyclonal Anti-DND1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DND1 antibody: synthetic peptide directed towards the C terminal of human DND1. Synthetic peptide located within the following region: HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES |
Rabbit Polyclonal Anti-Dnd1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Dnd1 antibody is: synthetic peptide directed towards the middle region of Rat Dnd1. Synthetic peptide located within the following region: KYGGPPPGWVGSPPPSGSEVFIGRLPQDVYEHQLIPLFQRVGRLYEFRLM |
DND1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human DND1 |
DND1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DND1 |
DND1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DND1. |