Antibodies

View as table Download

Rabbit Polyclonal Anti-EEF1A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EEF1A2 antibody: synthetic peptide directed towards the middle region of human EEF1A2. Synthetic peptide located within the following region: VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP

EEF1A2 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse EEF1A2

EEF1A2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 184-463 of human EEF1A2 (NP_001949.1).
Modifications Unmodified