Antibodies

Jump to Filters
View as table Download
C10orf84 (FAM204A) Rabbit Polyclonal Antibody
TA330713

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAM204A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM204A antibody is: synthetic peptide directed towards the N-terminal region of Human FAM204A. Synthetic peptide located within the following region: NSGLNLQEDKEDESIRKTEIIDFSTDEPKTETESNVNAYEECPSGIPIDM
Fam204a Rabbit Polyclonal Antibody
TA363582

USD 360.00

5 Days

FAM204A Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse D19ERTD737E