Rabbit polyclonal Anti-Kir6.1
Applications | IHC, WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KRNSMRRNNSMRRSN, corresponding to amino acid residues 382-396 of rat Kir6.1. Intracellular, C-terminal part. |
Rabbit polyclonal Anti-Kir6.1
Applications | IHC, WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KRNSMRRNNSMRRSN, corresponding to amino acid residues 382-396 of rat Kir6.1. Intracellular, C-terminal part. |
Rabbit Polyclonal Anti-KCNJ8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNJ8 antibody: synthetic peptide directed towards the middle region of human KCNJ8. Synthetic peptide located within the following region: EKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPK |