Antibodies

View as table Download

Rabbit polyclonal Anti-KCNV1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNV1 antibody: synthetic peptide directed towards the N terminal of human KCNV1. Synthetic peptide located within the following region: ALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAVVVASYRRPGALAAVP

KCNV1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human KCNV1