Antibodies

View as table Download

Rabbit Polyclonal Anti-PANK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PANK2 antibody is: synthetic peptide directed towards the middle region of HUMAN PANK2. Synthetic peptide located within the following region: FGLPGWAVASSFGNMMSKEKREAVSKEDLARATLITITNNIGSIARMCAL

Rabbit Polyclonal Anti-PANK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PANK2 antibody is: synthetic peptide directed towards the C-terminal region of Human PANK2. Synthetic peptide located within the following region: FEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEK

Carrier-free (BSA/glycerol-free) PANK2 mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PANK2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PANK2 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PANK2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human PANK2 (NP_705902.2).

Anti-PANK2 mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-PANK2 mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-PANK2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PANK2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PANK2 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PANK2 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated