Antibodies

Jump to Filters
View as table Download
Pcmtd2 Rabbit Polyclonal Antibody
TA346795

USD 475.00

5 Days

Rabbit Polyclonal Anti-Pcmtd2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Pcmtd2 antibody is synthetic peptide directed towards the C-terminal region of Mouse Pcmtd2. Synthetic peptide located within the following region: LDKEVFASRISNPSDDTSCEDAEEDRREVAERTLQETKPEPPVNFLRQRV
PCMTD2 Rabbit Polyclonal Antibody
TA356745

USD 360.00

5 Days

PCMTD2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human PCMD2