Antibodies

View as table Download

Anti-PRSS1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 24-247 amino acids of human protease, serine, 1 (trypsin 1)

Rabbit Polyclonal Anti-PRSS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRSS1 antibody: synthetic peptide directed towards the N terminal of human PRSS1. Synthetic peptide located within the following region: LILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLIN

PRSS1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

PRSS1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PRSS1

PRSS1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-247 of human PRSS1 (NP_002760.1).
Modifications Unmodified