Antibodies

View as table Download

Rabbit Polyclonal Anti-Pus1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pus1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GGWVWEETEHPAKRVKGGEDEEPPRKLPKRKIVLLMAYSGKGYHGMQRNL

Rabbit Polyclonal Anti-PUS1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PUS1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PTIVSTERDERSMAQWLNTLPIHNFSGTALGAADTGAKVPSSLEGSEGDG

PUS1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

PUS1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 308-427 of human PUS1 (NP_079491.2).
Modifications Unmodified