Antibodies

View as table Download

Rabbit Polyclonal Anti-RNF41 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF41 antibody: synthetic peptide directed towards the middle region of human RNF41. Synthetic peptide located within the following region: QQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETI

Carrier-free (BSA/glycerol-free) RNF41 mouse monoclonal antibody,clone OTI2C1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RNF41 mouse monoclonal antibody,clone OTI2C1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RNF41 mouse monoclonal antibody,clone OTI2C1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated