Rabbit Polyclonal Anti-Choline Transporter (CHT) (extracellular)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)DWNQTAYGYPDPK, corresponding to amino acid residues 299-311 of mouse Choline Transporter. 4th extracellular loop. |
Rabbit Polyclonal Anti-SLC5A7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC5A7 Antibody: synthetic peptide directed towards the middle region of human SLC5A7. Synthetic peptide located within the following region: DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV |
Rabbit Polyclonal Anti-SLC5A7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC5A7 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC5A7. Synthetic peptide located within the following region: ILVKNENIKLDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNL |
SLC5A7 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 421-580 of human SLC5A7 (NP_068587.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
