Antibodies

View as table Download

Rabbit Polyclonal Anti-SNAP23 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNAP23 antibody: synthetic peptide directed towards the N terminal of human SNAP23. Synthetic peptide located within the following region: GIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPC

Goat Anti-SNAP23 (aa 135-144) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TDKADTNRDR, from the C Terminus of the protein sequence according to NP_003816.2; NP_570710.1.

Rabbit Polyclonal Anti-SNAP23 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SNAP23

SNAP23 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse SNAP23

SNAP23 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SNAP23

SNAP23 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-211 of human SNAP23 (NP_003816.2).
Modifications Unmodified