Rabbit Polyclonal Anti-ZHX3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZHX3 antibody: synthetic peptide directed towards the middle region of human ZHX3. Synthetic peptide located within the following region: DLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSEDQGPGTGELTAVH |
Rabbit Polyclonal Anti-ZHX3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZHX3 antibody: synthetic peptide directed towards the middle region of human ZHX3. Synthetic peptide located within the following region: ETKMTRREIDSWFSERRKKVNAEETKKAEENASQEEEEAAEDEGGEEDLA |
Rabbit polyclonal anti-Zhx3 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Zhx3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NGEPVAVHKVLGDAYSELSENSESWEPSAPEASSEPFDTSSPQSGRQLEA |
ZHX3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZHX3 |
Germany
Japan
United Kingdom
China