Antibodies

Jump to Filters
View as table Download
ABCD2 Rabbit Polyclonal Antibody
TA308846

USD 415.00

In Stock

Rabbit polyclonal antibody to ABCD2 (ATP-binding cassette, sub-family D (ALD), member 2)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 338 and 588 of ABCD2 (Uniprot ID#Q9UBJ2)
ABCD2 Goat Polyclonal Antibody
TA311321

USD 375.00

5 Days

Goat Anti-ABCD2 (aa460-473) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PLSDTLAIKGKVID, from the internal region of the protein sequence according to NP_005155.1.
ABCD2 Rabbit Polyclonal Antibody
TA332069

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABCD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCD2 Antibody: synthetic peptide directed towards the N terminal of human ABCD2. Synthetic peptide located within the following region: FIIKLIKWLMIAIPATFVNSAIRYLECKLALAFRTRLVDHAYETYFTNQT
ABCD2 Rabbit Polyclonal Antibody
TA332070

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABCD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCD2 Antibody: synthetic peptide directed towards the middle region of human ABCD2. Synthetic peptide located within the following region: WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT
ABCD2 Mouse Monoclonal Antibody [Clone ID: OTI3B7]
CF810066

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABCD2 mouse monoclonal antibody,clone OTI3B7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ABCD2 Rabbit Polyclonal Antibody
TA322663

USD 345.00

4 Weeks

Anti-ABCD2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 274-288 amino acids of human ATP-binding cassette, sub-family D (ALD), member 2
ABCD2 Rabbit Polyclonal Antibody
TA373141

USD 275.00

3 Weeks

ABCD2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 420-500 of human ABCD2 (NP_005155.1).
Modifications Unmodified
ABCD2 Mouse Monoclonal Antibody [Clone ID: OTI3B7]
TA810066

USD 379.00

In Stock

ABCD2 mouse monoclonal antibody,clone OTI3B7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ABCD2 Mouse Monoclonal Antibody [Clone ID: OTI3B7]
TA810066S

USD 159.00

2 Days

ABCD2 mouse monoclonal antibody,clone OTI3B7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated