Rabbit Polyclonal Anti-Ankra2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ankra2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ankra2. Synthetic peptide located within the following region: VAMGMKFILPNRFDMNVCSRFVKSLNEEDSKNIQDQVNSDLEVASVLFKA |
Rabbit Polyclonal Anti-ANKRA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANKRA2 antibody: synthetic peptide directed towards the C terminal of human ANKRA2. Synthetic peptide located within the following region: YAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESH |
Carrier-free (BSA/glycerol-free) ANKRA2 mouse monoclonal antibody, clone OTI8A9 (formerly 8A9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-ANKRA2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 299-313 amino acids of human ankyrin repeat, family A (RFXANK-like), 2 |
ANKRA2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ANKRA2 antibody is: synthetic peptide directed towards the N-terminal region of Human ANRA2 |
ANKRA2 mouse monoclonal antibody, clone OTI8A9 (formerly 8A9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ANKRA2 mouse monoclonal antibody, clone OTI8A9 (formerly 8A9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
