Rabbit Polyclonal Anti-ARL11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARL11 antibody: synthetic peptide directed towards the middle region of human ARL11. Synthetic peptide located within the following region: WKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANK |
ARL11 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-196 of human ARL11 (NP_612459.1). |
| Modifications | Unmodified |
ARL11 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ARL11 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
