Goat Anti-C1D Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SKNASKVANKGKSKS, from the C Terminus of the protein sequence according to NP_775269.1. |
Goat Anti-C1D Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SKNASKVANKGKSKS, from the C Terminus of the protein sequence according to NP_775269.1. |
Rabbit Polyclonal Anti-C1D Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C1D antibody: synthetic peptide directed towards the N terminal of human C1D. Synthetic peptide located within the following region: AGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLE |
Rabbit Polyclonal Anti-C1D Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C1D antibody: synthetic peptide directed towards the middle region of human C1D. Synthetic peptide located within the following region: LDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNR |
Carrier-free (BSA/glycerol-free) C1D mouse monoclonal antibody,clone OTI1E7
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C1D mouse monoclonal antibody,clone OTI5B3
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C1D mouse monoclonal antibody,clone OTI5H10
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
C1D mouse monoclonal antibody,clone OTI1E7
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
C1D mouse monoclonal antibody,clone OTI1E7
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
C1D mouse monoclonal antibody,clone OTI5B3
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
C1D mouse monoclonal antibody,clone OTI5B3
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
C1D mouse monoclonal antibody,clone OTI5H10
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
C1D mouse monoclonal antibody,clone OTI5H10
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |