Rabbit Polyclonal antibody to Creatine kinase 1B (creatine kinase, mitochondrial 1B)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 63 and 287 of Creatine kinase MT 1B (Uniprot ID#P12532) |
Rabbit Polyclonal Anti-CKMT1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CKMT1B Antibody is: synthetic peptide directed towards the N-terminal region of Human CKMT1B. Synthetic peptide located within the following region: TVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGY |
Mouse Monoclonal CKMT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Anti-CKMT1A/CKMT1B Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 32-46 amino acids of human creatine kinase, mitochondrial 1B |
CKMT1B Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human CKMT1B (NP_066270.1). |
| Modifications | Unmodified |
CKMT1 Mouse monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
