Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-F10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F10 antibody: synthetic peptide directed towards the C terminal of human F10. Synthetic peptide located within the following region: STLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQ |
Rabbit polyclonal FA10 (activated heavy chain, Cleaved-Ile235) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human FA10. |
Rabbit polyclonal FA10 (light chain, Cleaved-Ala41) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human FA10. |
Factor X (F10) mouse monoclonal antibody, clone F10-1, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F10 mouse monoclonal antibody,clone OTI1D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F10 mouse monoclonal antibody,clone OTI3A9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F10 mouse monoclonal antibody,clone OTI1B8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-F10 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 235-488 amino acids of human coagulation factor X |
Anti-F10 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 235-488 amino acids of human coagulation factor X |
F10 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 41-300 of human F10 (NP_000495.1). |
| Modifications | Unmodified |
F10 mouse monoclonal antibody,clone OTI1D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
F10 mouse monoclonal antibody,clone OTI1D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
F10 mouse monoclonal antibody,clone OTI3A9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
F10 mouse monoclonal antibody,clone OTI3A9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
F10 mouse monoclonal antibody,clone OTI1B8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
F10 mouse monoclonal antibody,clone OTI1B8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- F10
Conjugates
- Unconjugated