Antibodies

View as table Download

Rabbit monoclonal anti-FABP4 antibody for SISCAPA, clone OTIR5E9

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti-FABP4 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FABP4

Mouse monoclonal anti-FABP4 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-FABP4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP4 antibody: synthetic peptide directed towards the middle region of human FABP4. Synthetic peptide located within the following region: FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM

Rabbit Polyclonal Anti-FABP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP4 antibody: synthetic peptide directed towards the middle region of human FABP4. Synthetic peptide located within the following region: FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM

Anti-FABP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

FABP4 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FABP4