Antibodies

View as table Download

GAS2L3 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GAS2L3

Rabbit polyclonal Anti-GAS2L3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GAS2L3 antibody is: synthetic peptide directed towards the N-terminal region of HUMAN GAS2L3. Synthetic peptide located within the following region: SISIPKSCCRHEELHEAVKHIAEDPPCSCSHRFSIEYLSEGRYRLGDKIL