Antibodies

Jump to Filters
View as table Download
GPR88 Rabbit Polyclonal Antibody
TA316859

USD 425.00

5 Days

GPR88 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla
Conjugation Unconjugated
Immunogen GPR88 antibody was raised against synthetic 18 amino acid peptide from 1st cytoplasmic domain of human GPR88. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Mouse, Rat, Bovine, Hamster, Panda, Rabbit, Opossum (100%); Turkey, Chicken (89%); Lizard, Xenopus (83%).
Gpr88 Rabbit Polyclonal Antibody
TA329464

USD 375.00

5 Days

Rabbit Polyclonal anti-Gpr88 antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Gpr88 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LYTWRNEEFRRSVRSVLPGVGDAAAAAAAATAVPAMSQAQLGTRAAGQHW