Antibodies

Jump to Filters
View as table Download
Kcnj8 Rabbit Polyclonal Antibody
TA328967

USD 585.00

3 Weeks

Rabbit polyclonal Anti-Kir6.1

Applications IHC, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide (C)KRNSMRRNNSMRRSN, corresponding to amino acid residues 382-396 of rat Kir6.1. Intracellular, C-terminal part.
KCNJ8 Rabbit Polyclonal Antibody
TA338551

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNJ8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ8 antibody: synthetic peptide directed towards the middle region of human KCNJ8. Synthetic peptide located within the following region: EKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPK