Rabbit Polyclonal Lin28 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Lin28 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human Lin28. |
Rabbit Polyclonal Lin28 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Lin28 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human Lin28. |
Rabbit polyclonal LIN28A Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | This LIN28A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-138 amino acids from the Central region of human LIN28A. |
Rabbit Polyclonal LIN-28A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Partial recombinant human Lin28 protein expressed in E. coli. [Swiss-Prot# Q9H9Z2] |
Anti-LIN28A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa. 1~5 (M-G-S-V-S) derived from Human Lin28 |
Rabbit Polyclonal Anti-LIN28 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LIN28 Antibody: synthetic peptide directed towards the N terminal of human LIN28. Synthetic peptide located within the following region: GSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRM |
Mouse Monoclonal Lin28 Monoclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal LIN28A Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LIN28A Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LIN28A |
LIN28 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 142-209 of human LIN28 (NP_078950.1). |
Modifications | Unmodified |
LIN28A (9G2) Mouse monoclonal Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |