Rabbit Polyclonal Anti-MAP3K15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP3K15 antibody: synthetic peptide directed towards the C terminal of human MAP3K15. Synthetic peptide located within the following region: YQNLLRQTLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRL |
Carrier-free (BSA/glycerol-free) MAP3K15 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MAP3K15 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MAP3K15 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China