Antibodies

View as table Download

Rabbit Polyclonal Anti-MAP4K2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP4K2 antibody: synthetic peptide directed towards the N terminal of human MAP4K2. Synthetic peptide located within the following region: TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR

Rabbit Polyclonal Anti-MAP4K2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP4K2 antibody: synthetic peptide directed towards the N terminal of human MAP4K2. Synthetic peptide located within the following region: HLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAE

Rabbit Polyclonal Anti-MAP4K2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MAP4K2

MAP4K2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MAP4K2

MAP4K2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 551-820 of human MAP4K2 (NP_004570.2).
Modifications Unmodified

MAP4K2/3 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthesized peptide derived from human GCK/GLK. at AA range: 221-270