Antibodies

Jump to Filters
View as table Download
Mucolipin 1 (MCOLN1) Rabbit Polyclonal Antibody
TA309745

USD 457.00

5 Days

Rabbit Polyclonal Mucolipin 1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the mouse protein (within residues 500-580). [Swiss-Prot# Q99J21]
Mcoln1 Rabbit Polyclonal Antibody
TA328757

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-TRPML1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)GRRASETERLLTPN, corresponding to amino acid residues 6-19 of mouse TRPLM1. Intracellular, N-terminus (cytoplasmic).
Mucolipin 1 (MCOLN1) Rabbit Polyclonal Antibody
TA338593

USD 375.00

5 Days

Rabbit Polyclonal Anti-MCOLN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCOLN1 antibody: synthetic peptide directed towards the N terminal of human MCOLN1. Synthetic peptide located within the following region: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV