Antibodies

Jump to Filters
View as table Download
PC1/3 (PCSK1) Rabbit Polyclonal Antibody
TA334299

USD 375.00

5 Days

Rabbit Polyclonal Anti-PCSK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCSK1 antibody: synthetic peptide directed towards the middle region of human PCSK1. Synthetic peptide located within the following region: QSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTK