Antibodies

View as table Download

Mouse Monoclonal PGRP1A Antibody (187C434)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-PGLYRP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PGLYRP3 antibody is: synthetic peptide directed towards the N-terminal region of Human PGLYRP3. Synthetic peptide located within the following region: SVCSQMLRGLQSHSVYTIGWCDVAYNFLVGDDGRVYEGVGWNIQGLHTQG