Antibodies

Jump to Filters
View as table Download
PGPEP1 Rabbit Polyclonal Antibody
TA331888

USD 375.00

5 Days

Rabbit Polyclonal Anti-PGPEP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PGPEP1 Antibody is: synthetic peptide directed towards the N-terminal region of Human PGPEP1. Synthetic peptide located within the following region: KHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGP