Rabbit polyclonal anti-PKA regulatory subunit I beta antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KAP1. |
Rabbit polyclonal anti-PKA regulatory subunit I beta antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KAP1. |
Rabbit Polyclonal Anti-PRKAR1B Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRKAR1B antibody: synthetic peptide directed towards the middle region of human PRKAR1B. Synthetic peptide located within the following region: LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT |
Carrier-free (BSA/glycerol-free) PRKAR1B mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRKAR1B mouse monoclonal antibody, clone OTI9C5 (formerly 9C5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRKAR1B mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRKAR1B mouse monoclonal antibody, clone OTI12E5 (formerly 12E5)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PRKAR1B rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 50-62 amino acids of Human protein kinase, cAMP-dependent, regulatory, type I, beta |
Anti-PRKAR1B Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 50-62 amino acids of Human protein kinase, cAMP-dependent, regulatory, type I, beta |
PRKAR1B Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 190-290 of human PRKAR1B (NP_002726.1). |
Modifications | Unmodified |
PRKAR1B (PKA regulatory subunit I beta) mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRKAR1B (PKA regulatory subunit I beta) mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRKAR1B mouse monoclonal antibody, clone OTI9C5 (formerly 9C5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRKAR1B mouse monoclonal antibody, clone OTI9C5 (formerly 9C5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRKAR1B mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRKAR1B mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRKAR1B mouse monoclonal antibody, clone OTI12E5 (formerly 12E5)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRKAR1B mouse monoclonal antibody, clone OTI12E5 (formerly 12E5)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |