Antibodies

Jump to Filters
View as table Download
QARS1 Rabbit Polyclonal Antibody
TA342240

USD 375.00

5 Days

Rabbit polyclonal Anti-QARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-QARS antibody: synthetic peptide directed towards the N terminal of human QARS. Synthetic peptide located within the following region: DQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLEITGGQV
QARS1 Rabbit Polyclonal Antibody
TA380595

USD 220.00

3 Weeks

QARS Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human QARS (NP_005042.1).
Modifications Unmodified