Germany
Japan
United Kingdom
China
Mouse Monoclonal Rad51D Antibody (5B3/6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal Anti-RAD51D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD51D antibody is: synthetic peptide directed towards the C-terminal region of Human RAD51D. Synthetic peptide located within the following region: RLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSRQPTGFQEM |
RAD51L3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
RAD51D Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human RA51D |
RAD51D Antibody - Middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RAD51D antibody is: synthetic peptide directed towards the Middle region of Human RA51D |
Rad51D Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-328 of human Rad51D (NP_002869.3). |
| Modifications | Unmodified |
Rad51D Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-328 of human Rad51D (NP_002869.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RAD51D
Conjugates
- Unconjugated