Rabbit Polyclonal Anti-RPL11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL11 antibody is: synthetic peptide directed towards the C-terminal region of Human RPL11. Synthetic peptide located within the following region: DFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIILPGK |
Rabbit Polyclonal Anti-RPL11 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPL11 |
RPL11 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-177 of human RPL11 (NP_001186731.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
