Rabbit polyclonal anti-SCFD1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human SCFD1. |
Rabbit polyclonal anti-SCFD1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human SCFD1. |
Rabbit polyclonal Anti-SCFD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCFD1 antibody: synthetic peptide directed towards the N terminal of human SCFD1. Synthetic peptide located within the following region: SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEME |
Rabbit polyclonal Anti-SCFD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SCFD1 antibody is: synthetic peptide directed towards the C-terminal region of Human SCFD1. Synthetic peptide located within the following region: YFDPKMLRGNDSSVPRNKNPFQEAIVFVVGGGNYIEYQNLVDYIKGKQGK |
Carrier-free (BSA/glycerol-free) SCFD1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SCFD1 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SCFD1 mouse monoclonal antibody, clone OTI2B7 (formerly 2B7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SCFD1 mouse monoclonal antibody,clone OTI1F4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SCFD1 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SCFD1 mouse monoclonal antibody,clone OTI4D2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SCFD1 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SCFD1 mouse monoclonal antibody, clone OTI10D8 (formerly 10D8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SCFD1 mouse monoclonal antibody,clone OTI10D10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SCFD1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 373-642 of human SCFD1 (NP_057190.2). |
Modifications | Unmodified |
SCFD1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody, clone OTI2B7 (formerly 2B7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody, clone OTI2B7 (formerly 2B7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody,clone OTI1F4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody,clone OTI1F4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody,clone OTI4D2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody,clone OTI4D2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody, clone OTI10D8 (formerly 10D8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody, clone OTI10D8 (formerly 10D8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody,clone OTI10D10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SCFD1 mouse monoclonal antibody,clone OTI10D10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |