Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-SCMH1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCMH1 antibody: synthetic peptide directed towards the middle region of human SCMH1. Synthetic peptide located within the following region: LTGDNLQPPGTKVVIPKNPYPASDVNTEKPSIHSSTKTVLEHQPGQRGRK |
Rabbit Polyclonal Anti-SCMH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCMH1 antibody: synthetic peptide directed towards the middle region of human SCMH1. Synthetic peptide located within the following region: KTAEPLKFPKKRGPKPGSKRKPRTLLNPPPASPTTSTPEPDTSTVPQDAA |
Carrier-free (BSA/glycerol-free) SCMH1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SCMH1 mouse monoclonal antibody, clone OTI6F10 (formerly 6F10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SCMH1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SCMH1 |
SCMH1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SCMH1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SCMH1 mouse monoclonal antibody, clone OTI6F10 (formerly 6F10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SCMH1 mouse monoclonal antibody, clone OTI6F10 (formerly 6F10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SCMH1
Conjugates
- Unconjugated