Antibodies

Jump to Filters
View as table Download
SF3B5 Rabbit Polyclonal Antibody
TA343080

USD 375.00

5 Days

Rabbit Polyclonal Anti-SF3B5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Sf3b5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sf3b5. Synthetic peptide located within the following region: RDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPSGPPADKPEEN
SF3B5 Rabbit Polyclonal Antibody
TA381424

USD 220.00

3 Weeks

SF3B5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SF3B5 (NP_112577.1).
Modifications Unmodified