Rabbit Polyclonal Anti-SRY Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRY antibody: synthetic peptide directed towards the middle region of human SRY. Synthetic peptide located within the following region: SEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL |
Rabbit polyclonal anti-SRY antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SRY. |
SRY Capture mouse monoclonal antibody, Luminex validated, clone OTI1H10
| Applications | LMNX |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SRY mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SRY mouse monoclonal antibody, clone OTI2C7 (formerly 2C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SRY mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SRY mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SRY mouse monoclonal antibody, clone OTI2C7 (formerly 2C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SRY mouse monoclonal antibody, clone OTI2C7 (formerly 2C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
