Antibodies

Jump to Filters
View as table Download
TARSL2 Rabbit Polyclonal Antibody
TA331627

USD 375.00

5 Days

Rabbit Polyclonal Anti-TARSL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TARSL2 Antibody is: synthetic peptide directed towards the C-terminal region of Human TARSL2. Synthetic peptide located within the following region: TYVSKDGDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMV
TARSL2 Rabbit Polyclonal Antibody
TA382312

USD 220.00

3 Weeks

TARSL2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human TARSL2 (NP_689547.2).
Modifications Unmodified