Antibodies

Jump to Filters
View as table Download
ASCC2 Rabbit Polyclonal Antibody
TA329492

USD 375.00

5 Days

Rabbit Polyclonal anti-ASCC2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASCC2 antibody: synthetic peptide directed towards the middle region of human ASCC2. Synthetic peptide located within the following region: YEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPREGQEEDD
ASCC2 Rabbit Polyclonal Antibody
TA350949

USD 345.00

In Stock

Rabbit Polyclonal Anti-ASCC2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ASCC2