Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal TIM-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TIM-1 antibody was raised against a 16 amino acid peptide from near the center of human TIM-1. |
Goat Polyclonal Anti-IL17C (aa160-172) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL17C (aa160-172) Antibody: Peptide with sequence RRPCSRDGSGLPT, from the internal region of the protein sequence according to NP_037410.1. |
Rabbit Polyclonal Anti-HAVCR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAVCR1 antibody: synthetic peptide directed towards the N terminal of human HAVCR1. Synthetic peptide located within the following region: CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSR |
Anti-HAVCR1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 72-89 amino acids of Human hepatitis A virus cellular receptor 1 |
Active filters
Target Symbol
- HAVCR1
Isotypes
- IgG
Families
- Druggable Genome