Antibodies

Jump to Filters
View as table Download
HTR1B Goat Polyclonal Antibody
TA302601

USD 375.00

5 Days

Goat Polyclonal Antibody against Serotonin receptor 1B / HTR1B

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SNEDFKQAFHK, from the C Terminus of the protein sequence according to NP_000854.1.
HTR1B Rabbit Polyclonal Antibody
TA330445

USD 310.00

5 Days

Rabbit Polyclonal Anti-HTR1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR1B antibody: synthetic peptide directed towards the N terminal of human HTR1B. Synthetic peptide located within the following region: MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKV