Rabbit polyclonal anti-IL-19 Polyclonal antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | E. coli-expressed recombinant murine IL-19 |
Rabbit polyclonal anti-IL-19 Polyclonal antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | E. coli-expressed recombinant murine IL-19 |
Rabbit Polyclonal Anti-IL19 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL19 antibody is: synthetic peptide directed towards the C-terminal region of Human IL19. Synthetic peptide located within the following region: KILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLE |
Rabbit Polyclonal Anti-IL19 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IL19 |