Antibodies

View as table Download

Rabbit Polyclonal Anti-HTATIP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HTATIP Antibody: synthetic peptide directed towards the middle region of human HTATIP. Synthetic peptide located within the following region: VEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEI

Rabbit Polyclonal KAT5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KAT5 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human KAT5.

Rabbit polyclonal anti-TIP60 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TIP60.

Rabbit polyclonal Tip60 (Ser90) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Tip60 around the phosphorylation site of serine 90 (P-G-SP-P-E).
Modifications Phospho-specific

Rabbit Polyclonal Anti-HTATIP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTATIP antibody: synthetic peptide directed towards the N terminal of human HTATIP. Synthetic peptide located within the following region: EGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWV

Rabbit polyclonal TIP60 (Ser86) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human TIP60 around the phosphorylation site of serine 86 (P-G-SP-R-P).
Modifications Phospho-specific

Rabbit Polyclonal Anti-HTATIP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTATIP antibody: synthetic peptide directed towards the N terminal of human HTATIP. Synthetic peptide located within the following region: EAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKERE

Rabbit Polyclonal Anti-KAT5 Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KAT5