Antibodies

Jump to Filters
View as table Download
NR0B1 Rabbit Polyclonal Antibody
TA332425

USD 275.00

3 Weeks

Rabbit anti-NR0B1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human NR0B1
NR0B1 Rabbit Polyclonal Antibody
TA308648

USD 415.00

5 Days

Rabbit Polyclonal antibody to NR0B1 (nuclear receptor subfamily 0, group B, member 1)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 96 and 406 of NR0B1 (Uniprot ID#P51843)
NR0B1 Rabbit Polyclonal Antibody
TA346490

USD 475.00

5 Days

Rabbit Polyclonal Anti-NR0B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the N terminal of human NR0B1. Synthetic peptide located within the following region: MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVG
NR0B1 Rabbit Polyclonal Antibody
TA346491

USD 475.00

5 Days

Rabbit Polyclonal Anti-NR0B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the middle region of human NR0B1. Synthetic peptide located within the following region: FCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKS
NR0B1 Rabbit Polyclonal Antibody
TA329362

USD 375.00

5 Days

Rabbit Polyclonal anti-NR0B1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the middle region of human NR0B1. Synthetic peptide located within the following region: QAIKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQ
NR0B1 Rabbit Polyclonal Antibody
TA338375

USD 310.00

5 Days

Rabbit Polyclonal Anti-NR0B1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the N terminal of human NR0B1. Synthetic peptide located within the following region: TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC
NR0B1 Goat Polyclonal Antibody
TA303234

USD 375.00

5 Days

Goat Polyclonal Antibody against NR0B1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CGEDHPQQGSTLY, from the internal region of the protein sequence according to NP_000466.2.