Antibodies

View as table Download

Rabbit polyclonal anti-OPN5 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OPN5.

Rabbit polyclonal antibody to neuropsin (opsin 5)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 110 and 203 of Opsin 5 (Uniprot ID#Q6U736)

Rabbit Polyclonal Anti-OPN5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OPN5 antibody: synthetic peptide directed towards the C terminal of human OPN5. Synthetic peptide located within the following region: FFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKLTKVA